Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NG94-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-68 (68) MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFSCEWTIQIFLFSLFTTTYALTITGNGAIAFVLWCDR PA
0
70-95 (26) LHTPMYMFLGNFSFLEIWYVSSTVPK PA
2
96-104 (9) MLVNFLSEK PA
3
106-158 (53) NISFAGCFLQFYFFFSLGTSECLLLTVMAFDQYLAICRPLLYPNIMTGHLYAK PA
1
159-199 (41) LVILCWVCGFLWFLIPIVLISQMPFCGPNIIDHVVCDPGPR PA
1
200-209 (10) FALDCVSAPR PA
1
210-238 (29) IQLFCYTLSSLVIFGNFLFIIGSYTLVLK PA
2
239-249 (11) AMLGMPSSTGR PA
0
252-287 (36) AFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQK PA
1
288-310 (23) IETLFYAMVTPLFNPLIYSLQNK PA
2
319-326 (8) VLGSSNII PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center