Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MTEFHLQSQMPSIR PA
0
25-32 (8) IKPSQSPR PA
0
33-50 (18) CSTSFMVVPSFSIAEHWR PA
0
54-76 (23) GANLSQGMEFELLGLTTDPQLQR PA
0
77-115 (39) LLFVVFLGMYTATLLGNLVMFLLIHVSATLHTPMYSLLK PA
0
116-139 (24) SLSFLDFCYSSTVVPQTLVNFLAK PA
0
142-173 (32) VISYFGCMTQMFFYAGFATSECYLIAAMAYDR PA
0
174-218 (45) YAAICNPLLYSTIMSPEVCASLIVGSYSAGFLNSLIHTGCIFSLK PA
0
219-278 (60) FCGAHVVTHFFCDGPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYFLILNTILK PA
0
288-314 (27) AFSTCASHLTAICLFFGTTLFMYLRPR PA
0
315-323 (9) SSYSLTQDR PA
0
324-344 (21) TVAVIYTVVIPVLNPLMYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center