Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MDSLNQTR PA
0
9-21 (13) VTEFVFLGLTDNR PA
0
22-80 (59) VLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMYFFLSNLSFIDICHSSVTVPK PA
0
81-89 (9) MLEGLLLER PA
0
91-122 (32) TISFDNCITQLFFLHLFACAEIFLLIIVAYDR PA
0
123-139 (17) YVAICTPLHYPNVMNMR PA
0
140-165 (26) VCIQLVFALWLGGTVHSLGQTFLTIR PA
0
166-186 (21) LPYCGPNIIDSYFCDVPLVIK PA
0
187-226 (40) LACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLR PA
0
236-269 (34) ALSTCSAHFMVVALFFGPCIFIYTRPDTSFSIDK PA
0
270-290 (21) VVSVFYTVVTPLLNPFIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center