Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-28 (23) NTSLDAVVTDFILLGLSHPPNLR PA
0
29-58 (30) SLLFLVFFIIYILTQLGNLLILLTMWADPK PA
0
59-85 (27) LCARPMYILLGVLSFLDMWLSSVTVPR PA
0
86-95 (10) LILDFTPSIK PA
0
96-127 (32) AIPFGGCVAQLYFFHFLGSTQCFLYTLMAYDR PA
0
128-144 (17) YLAICQPLHYPVLMNGR PA
0
145-170 (26) LCTVLVAGAWVAGSMHGSIQATLTFR PA
0
171-187 (17) LPYCGPNQVDYFICDIR PA
0
192-209 (18) LACADTTVNELVTFVDVR PA
0
210-232 (23) VVAASCFMLILLSYANIVHAILK PA
0
242-266 (25) AFSTCGSHLIVVTVYYVPCIFIYLR PA
0
271-296 (26) DPLDGAAAVFYTVVTPLLNPLIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center