Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-22 (19) INSTLLTAFILTGIPYPLR PA
0
25-54 (30) TLFFVFFFLIYILTQLGNLLILITVWADPR PA
0
55-81 (27) LHARPMYIFLGVLSVIDMSISSIIVPR PA
0
82-123 (42) LMMNFTLGVKPIPFGGCVAQLYFYHFLGSTQCFLYTLMAYDR PA
0
124-132 (9) YLAICQPLR PA
1
133-140 (8) YPVLMTAK PA
0
141-166 (26) LSALLVAGAWMAGSIHGALQAILTFR PA
0
167-187 (21) LPYCGPNQVDYFFCDIPAVLR PA
0
188-228 (41) LACADTTVNELVTFVDIGVVVASCFSLILLSYIQIIQAILR PA
0
238-292 (55) AFSTCGAHVTVVTVYYVPCAFIYLRPETNSPLDGAAALVPTAITPFLNPLIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center