Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGNWTAAVTEFVLLGFSLSR PA
0
21-53 (33) EVELLLLVLLLPTFLLTLLGNLLIISTVLSCSR PA
0
54-79 (26) LHTPMYFFLCNLSILDILFTSVISPK PA
0
80-87 (8) VLANLGSR PA
0
90-121 (32) TISFAGCITQCYFYFFLGTVEFLLLTVMSYDR PA
0
122-130 (9) YATICCPLR PA
0
131-226 (96) YTTIMRPSVCIGTVVFSWVGGFLSVLFPTILISQLPFCGSNIINHFFCDSGPLLALACADTTAIELMDFMLSSMVILCCIVLVAYSYTYIILTIVR PA
0
236-264 (29) AFNTCASHLTIVIIPSGITVFIYVTPSQK PA
0
272-292 (21) IPLVLSSVVTPFLNPFIYTLR PA
0
293-301 (9) NDTVQGVLR PA
0
333-344 (12) ACSSPPCVYSVK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center