Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGC7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MFFIIHSLVTSVFLTALGPQNR PA
0
23-39 (17) TMHFVTEFVLLGFHGQR PA
0
40-68 (29) EMQSCFFSFILVLYLLTLLGNGAIVCAVK PA
0
73-108 (36) LHTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIK PA
0
109-140 (32) TISFSGCFLQFYFFFSLGTTECFFLSVMAYDR PA
0
141-157 (17) YLAICRPLHYPSIMTGK PA
0
158-241 (84) FCIILVCVCWVGGFLCYPVPIVLISQLPFCGPNIIDHLVCDPGPLFALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVIR PA
0
242-252 (11) AVLCIPSGAGR PA
0
255-290 (36) AFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPAGMQK PA
0
291-311 (21) IITLVYTAMTPFLNPLIYSLR PA
0
322-330 (9) VLGLTVSQN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center