Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGD1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-50 (40) EFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIK PA
0
51-80 (30) SDPGLTAPLYFFLGNLAFLDASYSFIVAPR PA
0
81-89 (9) MLVDFLSAK PA
0
96-122 (27) GCITQLFFLHFLGGGEGLLLVVMAFDR PA
1
123-139 (17) YIAICRPLHYPTVMNPR PA
0
140-165 (26) TCYAMMLALWLGGFVHSIIQVVLILR PA
0
166-186 (21) LPFCGPNQLDNFFCDVPQVIK PA
0
187-224 (38) LACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCR PA
0
236-263 (28) AMSTCITHIIVIFFMFGPGIFIYTRPFR PA
0
270-290 (21) VVSLFHTVIFPLLNPVIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center