Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGD3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-22 (19) SNSSVVSEFVLLGLCSSQK PA
0
23-80 (58) LQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMYFLLGNLSFVDICQASFATPK PA
0
81-122 (42) MIADFLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAYDR PA
0
123-138 (16) YVAICKPLYYVVIMSR PA
0
140-183 (44) TCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPR PA
0
187-228 (42) LACLDSYIIEILIVVNSGILSLSTFSLLVSSYIIILVTVWLK PA
0
236-269 (34) AFSTLASHIAVVILFFGPCIFIYVWPFTISPLDK PA
0
270-290 (21) FLAIFYTVFTPVLNPIIYTLR PA
0
301-309 (9) IVNHYLRPR PA
0
311-319 (9) ISEMSLVVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center