Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGD5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MDPQNYSLVSEFVLHGLCTSR PA
0
22-81 (60) HLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPMYFLLGNLAFLDMWLASFATPK PA
0
92-123 (32) LISFGGCMAQIFFLHFTGGAEMVLLVSMAYDR PA
0
124-144 (21) YVAICKPLHYMTLMSWQTCIR PA
0
145-187 (43) LVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIK PA
0
188-227 (40) LACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIR PA
0
237-265 (29) ALSTCSAHIMVVTLFFGPCIFVYVRPFSR PA
0
271-291 (21) LLSVFYTIFTPLLNPIIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center