Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGT5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-52 (52) MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCVDK PA
0
54-90 (37) LQSPMYFFLSHLSTLEILVTTIIVPMMLWGLLFLGCR PA
0
91-118 (28) QYLSLHVSLNFSCGTMEFALLGVMAVDR PA
0
119-127 (9) YVAVCNPLR PA
3
128-165 (38) YNIIMNSSTCIWVVIVSWVFGFLSEIWPIYATFQFTFR PA
0
167-177 (11) SNSLDHFYCDR PA
0
183-223 (41) LSCDNTLLTEFILFLMAVFILIGSLIPTIVSYTYIISTILK PA
0
233-259 (27) AFSTFASHFTCVVIGYGSCLFLYVKPK PA
0
260-268 (9) QTQGVEYNK PA
0
269-289 (21) IVSLLVSVLTPFLNPFIFTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center