Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NGV7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-29 (29) MSNEDMEQDNTTLLTEFVLTGLTYQPEWK PA
0
30-85 (56) MPLFLVFLVIYLITIVWNLGLIALIWNDPQLHIPMYFFLGSLAFVDAWISSTVTPK PA
0
86-93 (8) MLVNFLAK PA
2
96-127 (32) MISLSECMIQFFSFAFGGTTECFLLATMAYDR PA
0
128-148 (21) YVAICKPLLYPVIMNNSLCIR PA
0
149-170 (22) LLAFSFLGGFLHALIHEVLIFR PA
0
171-232 (62) LTFCNSNIIHHFYCDIIPLFMISCTDPSINFLMVFILSGSIQVFTIVTVLNSYTFALFTILK PA
0
242-298 (57) AFSTCGAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYSLR PA
0
301-308 (8) QVIDSFTK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center