Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NH05-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-81 (78) EQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQAHAHLLQSPMYYFLGHLSFIDLCLSCVTVPK PA
0
82-91 (10) MLGDFLQQGK PA
0
92-123 (32) SISFSGCLAQIYFLHFLGASEMFLLTVMAYDR PA
0
124-132 (9) YVAICNPLR PA
17
133-187 (55) YLTVMNPQLCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYCDVPQVIK PA
0
188-227 (40) LACMDTYVVEVLVIANSGLLSLVCFLVLLFSYAIILITLR PA
0
228-236 (9) THFCQGQNK PA
0
237-270 (34) VFSTCASHLTVVSLIFVPCVFIYLRPFCSFSVDK PA
0
271-291 (21) IFSLFYTVITPMLNPLIYTLR PA
0
304-313 (10) IKPCGIPLPC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center