Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NH40-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-26 (26) MSPDGNHSSDPTEFVLAGLPNLNSAR PA
0
27-52 (26) VELFSVFLLVYLLNLTGNVLIVGVVR PA
0
57-82 (26) LQTPMYFFLGNLSCLEILLTSVIIPK PA
0
83-90 (8) MLSNFLSR PA
0
91-124 (34) QHTISFAACITQFYFYFFLGASEFLLLAVMSADR PA
0
125-133 (9) YLAICHPLR PA
0
134-145 (12) YPLLMSGAVCFR PA
0
146-172 (27) VALACWVGGLVPVLGPTVAVALLPFCK PA
0
173-189 (17) QGAVVQHFFCDSGPLLR PA
0
198-237 (40) LEETDFVLASLVIVSSLLITAVSYGLIVLAVLSIPSASGR PA
0
240-296 (57) AFSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALR PA
0
311-323 (13) VVAGVLGNLLLDK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center