Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NHA4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-80 (76) NQTSLADFILEGLFDDSLTHLFLFSLTMVVFLIAVSGNTLTILLICIDPQLHTPMYFLLSQLSLMDLMHVSTIILK PA
0
81-89 (9) MATNYLSGK PA
0
91-122 (32) SISFVGCATQHFLYLCLGGAECFLLAVMSYDR PA
0
123-131 (9) YVAICHPLR PA
24
140-172 (33) VGLMMAVMSWLGASVNSLIHMAILMHFPFCGPR PA
0
174-186 (13) VYHFYCEFPAVVK PA
0
187-228 (42) LVCGDITVYETTVYISSILLLLPIFLISTSYVFILQSVIQMR PA
0
235-262 (28) NAFATCGSHLTVVSLWFGACIFSYMRPR PA
0
263-271 (9) SQCTLLQNK PA
0
272-292 (21) VGSVFYSIITPTLNSLIYTLR PA
0
307-315 (9) DVITQCIQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center