Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NHB7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAEENHTMK PA
0
10-24 (15) NEFILTGFTDHPELK PA
1
25-53 (29) TLLFVVFFAIYLITVVGNISLVALIFTHR PA
0
55-80 (26) LHTPMYIFLGNLALVDSCCACAITPK PA
1
81-90 (10) MLENFFSENK PA
0
92-122 (31) ISLYECAVQFYFLCTVETADCFLLAAMAYDR PA
0
123-138 (16) YVAICNPLQYHIMMSK PA
1
140-165 (26) LCIQMTTGAFIAGNLHSMIHVGLVFR PA
1
166-186 (21) LVFCGSNHINHFYCDILPLYR PA
0
187-227 (41) LSCVDPYINELVLFIFSGSVQVFTIGSVLISYLYILLTIFK PA
0
237-270 (34) AFSTCASHFLSVSLFYGSLFFMYVRPNLLEEGDK PA
0
271-293 (23) DIPAAILFTIVVPLLNPFIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center