Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TAB5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-40 (40) MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAK PA
0
41-52 (12) DANENWHGMPGR PA
0
60-82 (23) SSSESPSDNQAFQAPGSPEEGVR PA
0
83-97 (15) SPPEGAEIPGAEPEK PA
0
98-123 (26) MGGAGTVCSPLEDNGYASSSLSIDSR PA
0
124-135 (12) SSSPEPACGTPR PA
0
136-159 (24) GPGPPDPLLPSVAQAVQHLQVQER PA
0
168-176 (9) HHVHLVMYR PA
0
178-185 (8) LALLQWIR PA
0
186-197 (12) GLQHQLIDQQAR PA
0
198-209 (12) LQESFDTILDNR PA
0
220-229 (10) AAPSRPQDQA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center