Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TCE6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MLSSDHLSTVEK PA
0
13-32 (20) DTNGEVLWVWCYPSTTATLR PA
2
39-46 (8) CCLTDENK PA
2
47-57 (11) LLHPFVFGQYR PA
2
59-75 (17) TWFYITTIEVPDSSILK PA
1
77-87 (11) VTHFSIVLTAK PA
2
114-124 (11) MMESYIAVLTK PA
2
125-138 (14) GICQSEENGSFLSK PA
2
145-152 (8) AYLAGSIK PA
1
153-172 (20) DIVSQFGMETVILHTALMLK PA
2
182-190 (9) IEAVQEFTR PA
2
191-199 (9) TLPALVWHR PA
2
200-259 (60) QDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAK PA
2
270-284 (15) EMGQLIVQSAEDPEK PA
2
285-296 (12) SESHVIQDIALK PA
1
299-316 (18) EIFTNLAPFSEVSADGEK PA
2
318-325 (8) VLNLEALK PA
2
329-348 (20) FPPATENFLYHLAAAEQMLK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2018 (C) Yonsei Proteome Research Center