Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TDI7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
22-30 (9) SGSPHTGDR PA
1
60-70 (11) AGGSPSPGSPR PA
1
81-88 (8) EELGEQER PA
1
135-163 (29) SSSLASSASGGESLSEEELAQILEQVEEK PA
1
172-179 (8) SKPWPMAK PA
1
186-193 (8) EAQEFVEK PA
1
229-237 (9) TQCIPWEMK PA
1
240-257 (18) DIESHFGSSVASYFIFLR PA
1
258-290 (33) WMYGVNLVLFGLIFGLVIIPEVLMGMPYGSIPR PA
1
301-315 (15) AMDFSVLWDFEGYIK PA
1
316-328 (13) YSALFYGYYNNQR PA
1
337-358 (22) LPMAYFMVGVSVFGYSLIIVIR PA
1
359-381 (23) SMASNTQGSTGEGESDNFTFSFK PA
1
382-399 (18) MFTSWDYLIGNSETADNK PA
1
400-408 (9) YASITTSFK PA
1
409-419 (11) ESIVDEQESNK PA
1
420-427 (8) EENIHLTR PA
1
431-453 (23) VLANFLIICCLCGSGYLIYFVVK PA
1
461-469 (9) MQNVSWYER PA
1
470-499 (30) NEVEIVMSLLGMFCPPLFETIAALENYHPR PA
1
509-531 (23) IFALFLGNLYTFLLALMDDVHLK PA
1
532-539 (8) LANEETIK PA
1
540-571 (32) NITHWTLFNYYNSSGWNESVPRPPLHPADVPR PA
1
572-585 (14) GSCWETAVGIEFMR PA
1
586-605 (20) LTVSDMLVTYITILLGDFLR PA
1
611-663 (53) FMNYCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR PA
0
664-684 (21) LLTSMYFQCWAVMSSNVPHER PA
1
691-729 (39) SNNFYMGLLLLVLFLSLLPVAYTIMSLPPSFDCGPFSGK PA
0
732-750 (19) MYDVLQETIENDFPTFLGK PA
0
751-780 (30) IFAFLANPGLIIPAILLMFLAIYYLNSVSK PA
0
825-833 (9) NATQLQLTK PA
0
834-849 (16) EETTPPSASQSQAMDK PA
0
851-862 (12) AQGPGTSNSASR PA
0
863-894 (32) TTLPASGHLPISRPPGIGPDSGHAPSQTHPWR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center