Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TDI7-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MIWMGSFYAPGLVGINVLR PA
0
20-40 (21) LLTSMYFQCWAVMSSNVPHER PA
1
47-83 (37) SNNFYMGLLLLVLFLSLLPVAYTIMSLPPSFDCGPFR PA
0
107-117 (11) IPVLVSCQPVK PA
0
118-130 (13) GHGTLGESPMPFK PA
0
132-140 (9) VFCQDGNVR PA
0
141-162 (22) SFCVCAVHFSSHQPPVAVECLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center