Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TDN4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-53 (53) MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPR PA
0
63-77 (15) QAALSFLTNISLDGR PA
0
78-105 (28) LPPQDAEWGGGEEGGAAKPGAGGACGAR PA
0
108-116 (9) FSLLAAAER PA
0
117-164 (48) GGCIALAAPGTPAAGLAAGSGPCLPQPSSLPPLIPGGHATVSGPGVAR PA
0
165-174 (10) GFASPLGAGR PA
0
175-237 (63) ASGEQWQPPRPAPLAACAQLQLLDGSGAAGQEELEEDDAFISVQVPAAAFLGSGTPGSGSGSR PA
0
240-280 (41) LNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQR PA
0
290-305 (16) SSLETLEDIEENAPLR PA
1
309-317 (9) TLSGSPRPK PA
1
346-357 (12) SFCSIFSVLPYR PA
2
358-366 (9) DSTQVGDLK PA
2
372-380 (9) QSTGAVSLK PA
2
381-395 (15) EIIGLEGVELGADGK PA
2
396-412 (17) TVSYTQFLLPTNAFGAR PA
2
414-426 (13) NTIDSTSSFSQFR PA
2
438-471 (34) ASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGK PA
2
475-495 (21) VLIFPSYMTTVIDYVKPSDLK PA
2
526-547 (22) LAQEDCGLEEPTVAMAFVYFEK PA
3
561-572 (12) LCAGACVLLAAK PA
4
599-627 (29) ELIAFEFPVLVALEFALHLPEHEVMPHYR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center