Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TDN4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-18 (8) IYADFPIR PA
0
25-40 (16) SSLETLEDIEENAPLR PA
1
44-52 (9) TLSGSPRPK PA
1
81-92 (12) SFCSIFSVLPYR PA
2
93-101 (9) DSTQVGDLK PA
2
107-115 (9) QSTGAVSLK PA
2
116-130 (15) EIIGLEGVELGADGK PA
2
131-147 (17) TVSYTQFLLPTNAFGAR PA
2
149-161 (13) NTIDSTSSFSQFR PA
2
173-206 (34) ASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGK PA
2
210-230 (21) VLIFPSYMTTVIDYVKPSDLK PA
2
261-282 (22) LAQEDCGLEEPTVAMAFVYFEK PA
3
296-307 (12) LCAGACVLLAAK PA
4
334-362 (29) ELIAFEFPVLVALEFALHLPEHEVMPHYR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center