Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TEP8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-15 (13) TSDLVPSFGYFIR PA
1
39-89 (51) EMAHLNHDLYSGDLNEQSQAQLSEGSITLQVEAVESTSQVDENDVTLTADK PA
2
92-104 (13) TEDTFFMSNKPQR PA
2
109-118 (10) LPDSGDSMLR PA
2
119-143 (25) ISTIASAIAEASVNTDPSQLAAMIK PA
2
168-176 (9) HFLPNDLEK PA
2
177-187 (11) SNGSNALDMEK PA
2
197-206 (10) YESALENFSR PA
2
207-219 (13) ASMSDTWDLSLPK PA
2
220-239 (20) EQTTQDIHPVDLSATSVSVR PA
2
240-263 (24) APEENTAAIVYVENGESENQESFR PA
2
264-274 (11) TINSSNSVTNR PA
2
275-284 (10) ENNSAVVDVK PA
2
292-300 (9) LQDVGNDEK PA
2
301-315 (15) ATSISTPSDSYSSVR PA
2
319-326 (8) ITSLCLLK PA
2
340-352 (13) QNECVSEISNSEK PA
2
353-360 (8) HVTFENHR PA
2
371-379 (9) NTSPEHGGR PA
2
380-443 (64) GSEDEQESFRPSTSPLSHSSPSEISGTSSSGCALESFGSAAQQQQPPCEQELSPLVCSPAGVSR PA
2
444-466 (23) LTYVSEPESSYPTTATDDALEDR PA
2
468-489 (22) SDITSELSTTIIQGSPAALEER PA
2
506-519 (14) GTLSSIIQNNSDTR PA
2
521-539 (19) ATETTSLSSKPEYVKPDFR PA
2
548-570 (23) SGNLLETSEVGWTSNPEELDPIR PA
2
577-602 (26) SGLSCQVGSATSHPVSCQEPIDEDQR PA
2
614-668 (55) EFSGQVSHQTTSENQCTPIPSSTVHSSVADMQNMPAAVHALLTQPSLSAAPFAQR PA
2
669-777 (109) YLGTLPSTGSTTLPQCHAGNATVCGFSGGLPYPAVAGEPVQNSVAVGICLGSNIGSGWMGTSSLCNPYSNTLNQNLLSTT
KPFPVPSVGTNCGIEPWDSGVTSGLGSVR PA
2
784-806 (23) LPHACCVGIASQTLLSVLNPTDR PA
2
807-823 (17) WLQVSIGVLSISVNGEK PA
2
838-849 (12) AIIRPHATEEIK PA
2
850-861 (12) VLFIPSSPGVFR PA
2
862-905 (44) CTFSVASWPCSTDAETIVQAEALASTVTLTAIAESPVIEVETEK PA
2
907-920 (14) DVLDFGDLTYGGWK PA
2
930-937 (8) THATVPIR PA
2
938-948 (11) LIINANAVAWR PA
2
959-972 (14) APVEVAPCADVVTR PA
2
973-1005 (33) LAGPSVVNHMMPASYDGQDPEFLMIWVLFHSPK PA
2
1007-1023 (17) QISSSDILDSAEEFSAK PA
2
1024-1038 (15) VDIEVDSPNPTPVLR PA
2
1056-1065 (10) DLQTMHFLAK PA
2
1078-1089 (12) NAGNIEVYLDIK PA
2
1090-1102 (13) VPEQGSHFSVDPK PA
2
1103-1121 (19) NLLLKPGEEHEVIVSFTPK PA
2
1122-1129 (8) DPEACEER PA
2
1133-1147 (15) IFVQPFGPQYEVVLK PA
2
1148-1173 (26) GEVISSGSKPLSPGPCLDIPSILSNK PA
2
1174-1185 (12) QFLAWGGVPLGR PA
2
1195-1205 (11) NNSASTTQHLR PA
2
1210-1227 (18) GQDQDCFQLQNTFGSEQR PA
2
1228-1235 (8) LTSNCEIR PA
2
1240-1252 (13) EDIFISVLFAPTR PA
2
1275-1294 (20) FTIPLSGYGGTSNLILEGVK PA
2
1296-1311 (16) LSDSYMVTVNGLVPGK PA
2
1361-1374 (14) TQENVTLIYNPSDR PA
2
1380-1397 (18) TATELSTVYLFGGDEISR PA
2
1403-1412 (10) ALLHKPEMIK PA
1
1413-1458 (46) QILPEHSVLQNINFVEAFQDELLVTEVYDLPQRPNDVQLFYGSMCK PA
1
1459-1468 (10) IILSVIGEFR PA
1
1475-1482 (8) EFLQPSSK PA
1
1483-1496 (14) ASLESTSDLGASGK PA
1
1497-1509 (13) HGGNVSLDVLPVK PA
1
1510-1519 (10) GPQGSPLLSR PA
1
1520-1553 (34) AARPPLDQLASEEPWTVLPEHLILVAPSPCDMAK PA
1
1557-1565 (9) FQIVNNSVR PA
1
1569-1592 (24) FELCWPAHCLTVTPQHGCVAPESK PA
1
1593-1606 (14) LQILVSPNSSLSTK PA
1
1607-1625 (19) QSMFPWSGLIYIHCDDGQK PA
1
1634-1644 (11) EDLTQVELLTR PA
1
1645-1675 (31) LTSKPFGILSPVSEPSVSHLVKPMTKPPSTK PA
1
1682-1709 (28) SITFPTTEPGETSESCLELENHGTTDVK PA
1
1710-1721 (12) WHLSSLAPPYVK PA
1
1722-1731 (10) GVDESGDVFR PA
1
1739-1753 (15) CSPISGLLESHGIQK PA
1
1754-1761 (8) VSITFLPR PA
1
1764-1778 (15) GDYAQFWDVECHPLK PA
1
1788-1813 (26) FQLSGQSIEAENEPENACLSTDSLIK PA
1
1814-1821 (8) IDHLVKPR PA
1
1823-1831 (9) QAVSEASAR PA
1
1832-1841 (10) IPEQLDVTAR PA
1
1842-1851 (10) GVYAPEDVYR PA
1
1852-1861 (10) FRPTSVGESR PA
1
1869-1878 (10) NNSFITHSLK PA
1
1897-1910 (14) AQHYINMPVQFKPK PA
1
1915-1927 (13) FEALLVIQTDEGK PA
1
1933-1940 (8) LIGEALGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center