Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8TEQ0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MSGSQNNDK PA
1
33-41 (9) EIASDSDSR PA
1
42-58 (17) VTCLCAQFEAVLQHGLK PA
1
62-71 (10) GLALTAAAIK PA
1
72-79 (8) QAAGFASK PA
1
80-91 (12) TETEPVFWYYVK PA
1
107-114 (8) HIASDVGR PA
1
121-130 (10) CALNEHSLER PA
1
131-139 (9) YLHMLLADR PA
1
142-157 (16) LSTFYEDWSFVMDEER PA
1
158-180 (23) SSMLPTMAAGLNSILFAINIDNK PA
1
188-197 (10) FAPTVSDLLK PA
1
198-208 (11) ESTQNVTSLLK PA
1
209-219 (11) ESTQGVSSLFR PA
1
220-245 (26) EITASSAVSILIKPEQETDPLPVVSR PA
1
263-283 (21) VTNIISFDDEEDEQNSGDVFK PA
1
285-298 (14) TPGAGESSEDNSDR PA
1
299-325 (27) SSVNIMSAFESPFGPNSNGSQSSNSWK PA
1
326-339 (14) IDSLSLNGEFGYQK PA
1
344-364 (21) SIDDEDVDENEDDVYGNSSGR PA
1
368-393 (26) GHSESPEKPLEGNTCLSQMHSWAPLK PA
1
394-438 (45) VLHNDSDILFPVSGVGSYSPADAPLGSLENGTGPEDHVLPDPGLR PA
1
439-471 (33) YSVEASSPGHGSPLSSLLPSASVPESMTISELR PA
1
472-480 (9) QATVAMMNR PA
1
482-489 (8) DELEEENR PA
1
493-506 (14) NLLDGEMEHSAALR PA
1
544-552 (9) YVGAVQMLK PA
1
554-590 (37) EGQTAEVPNLWSVDGEVTVAEQKPGEIAEELASSYER PA
1
592-608 (17) LIEVAEMHGELIEFNER PA
1
617-624 (8) EALVSQMR PA
1
632-655 (24) GPVPGDLSQTSEDQSLSDFEISNR PA
1
656-668 (13) ALINVWIPSVFLR PA
1
671-683 (13) AANAFHVYQVYIR PA
1
686-693 (8) DDEWNIYR PA
1
749-761 (13) VIQMVPEFAASPK PA
1
763-783 (21) ETLIQLMPFFVDWISLFGNGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center