Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WTP8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-23 (19) EAPESAQCLCPSLTIPNAK PA
1
45-81 (37) ALLQEQGLLSMPPEPGSSPLPTPFGAATATEAASSGK PA
1
86-95 (10) AGSGSAPCSR PA
1
102-109 (8) ASGPLPSK PA
1
110-123 (14) CVAIDCEMVGTGPR PA
1
132-145 (14) CSIVSYHGNVLYDK PA
1
146-157 (12) YIRPEMPIADYR PA
1
171-179 (9) AVPFQVAQK PA
1
189-203 (15) VVVGHALHNDFQALK PA
1
213-229 (17) DTTYVPNFLSEPGLHTR PA
1
236-244 (9) DLALQLLHK PA
1
246-267 (22) IQVGQHGHSSVEDATTAMELYR PA
1
268-279 (12) LVEVQWEQQEAR PA
1
280-288 (9) SLWTCPEDR PA
1
289-311 (23) EPDSSTDMEQYMEDQSTQYWALK PA
0
317-327 (11) QDSGLNSGAFV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center