Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WV41-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-16 (10) ALYDFHSENK PA
0
17-45 (29) EEISIQQDEDLVIFSETSLDGWLQGQNSR PA
0
46-60 (15) GETGLFPASYVEIVR PA
0
61-95 (35) SGISTNHADYSSSPAGSPGAQVSLYNSPSVASPAR PA
0
96-131 (36) SGGGSGFLSNQGSFEEDDDDDWDDWDDGCTVVEEPR PA
0
132-166 (35) AGGLGTNGHPPLNLSYPGAYPSQHMAFRPKPPLER PA
0
167-174 (8) QDSLASAK PA
0
192-207 (16) SGVEAFILGDVPMMAK PA
0
208-219 (12) IAETYSIEMGPR PA
0
225-239 (15) ANPHPFACSVEDPTK PA
0
254-265 (12) LTPTHAASPVYR PA
0
269-276 (8) HFDWLYNR PA
0
281-292 (12) FTVISVPHLPEK PA
0
298-305 (8) FEEDFIEK PA
0
310-339 (30) LILWMDHMTSHPVLSQYEGFQHFLSCLDDK PA
0
351-377 (27) DEMVGASFLLTFQIPTEHQDLQDVEDR PA
0
388-404 (17) MDDSVLQLSTVASELVR PA
0
417-448 (32) LGSAFQAISHSFQMDPPFCSEALNSAISHTGR PA
0
449-462 (14) TYEAIGEMFAEQPK PA
0
463-490 (28) NDLFQMLDTLSLYQGLLSNFPDIIHLQK PA
0
508-517 (10) MVQDEADGIR PA
0
522-537 (16) VVGFALQAEMNHFHQR PA
0
544-551 (8) HMMQNYLR PA
0
552-559 (8) QQILFYQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center