Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WW34-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-30 (24) VETDTIGAGEGPQQAVPWSAWVTR PA
1
36-55 (20) WWVSHMPPSWIQWWSTSNWR PA
1
61-101 (41) LLWGLEGILYLLLALMLCHALFTTGSHLLSSLWPVVAAVWR PA
1
102-152 (51) HLLPALLLLVLSALPALLFTASFLLLFSTLLSLVGLLTSMTHPGDTQDLDQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center