Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WWL2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-29 (26) AGSCGGAAAGAGRPEPWELSLEEVLK PA
1
30-49 (20) AYEQPLNEEQAWAVCFQGCR PA
1
61-68 (8) DTGDLLLR PA
1
69-76 (8) GDGSVGAR PA
1
77-107 (31) EPEAAEPATMVVPLASSEAQTVQSLGFAIYR PA
1
108-119 (12) ALDWGLDESEER PA
2
120-127 (8) ELSPQLER PA
2
128-163 (36) LIDLMANNDSEDSGCGAADEGYGGPEEEEEAEGVPR PA
2
184-194 (11) GAQAHYQAVCR PA
3
195-204 (10) ALFVETLELR PA
3
222-231 (10) EDEPHLETPR PA
3
232-244 (13) AELDSLGHTDWAR PA
3
262-287 (26) VQEQEFNPLPTEFQLTPFEMLMQDIR PA
3
296-305 (10) VMVDGDIPPR PA
2
309-319 (11) DAHELILDFIR PA
3
368-384 (17) GFGSLPCILNACSGDAK PA
3
385-406 (22) STSCINLSVTDAGGSAQRPRPR PA
3
411-436 (26) APTLAEMEEMNTSEEEESPCGEVTLK PA
3
440-450 (11) SFSEHDLAQLR PA
3
451-473 (23) SEVASGLQSATHPPGGTEPPRPR PA
3
474-485 (12) AGSAHVWRPGSR PA
3
486-505 (20) DQGTCPASVSDPSHPLLSNR PA
3
506-521 (16) GSSGDRPEASMTPDAK PA
3
522-545 (24) HLWLEFSHPVESLALTVEEVMDVR PA
3
579-592 (14) FPLFSWPPSCLFCK PA
3
594-602 (9) AVCTSCSIK PA
2
610-625 (16) FGHIPVYTLGFESPQR PA
2
638-666 (29) DIFQSLQGPQWQSVEEAFPHIYSHGCVLK PA
2
667-681 (15) DVCSECTSFVADVVR PA
3
686-695 (10) SVDVLNTTPR PA
3
699-709 (11) QTQSLYIPNTR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center