Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WXE1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAGTSAPGSK PA
1
13-32 (20) SEPPAPRPGPPPGTGHPPSK PA
1
36-79 (44) GFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQALSQCPAAAR PA
1
110-122 (13) DNFELEVLQAQYK PA
2
130-138 (9) VMEEEVLIK PA
3
147-160 (14) DSLHQTESVLEEQR PA
3
162-170 (9) SHFLLEQEK PA
3
185-195 (11) LQSLQSELQFK PA
3
196-203 (8) DAEMNELR PA
3
215-226 (12) LAAPSVSHVSPR PA
3
228-244 (17) NPSVVIKPEACSPQFGK PA
3
251-275 (25) ESFSANMSLPHPCQTESGYKPLVGR PA
3
276-284 (9) EDSKPHSLR PA
3
305-318 (14) SNTQGSILINLLLK PA
3
319-361 (43) QPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGLR PA
3
362-376 (15) TTGSYDGSFSLSALR PA
3
377-391 (15) EAQNLAFTGLNLVAR PA
3
397-405 (9) DGDPAEGGR PA
3
407-441 (35) AFPLCQLPGAVHFLPLVQFFIGLHCQALQDLAAAK PA
3
443-511 (69) SGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGVGADSAAGEGNR PA
3
517-527 (11) LSDGDMTSALR PA
3
528-540 (13) GVADDQGQHPLLK PA
3
541-566 (26) MLLHLLAFSSAATGHLQASVLTQCLK PA
3
571-582 (12) LAENTSCDFLPR PA
3
583-592 (10) FQCVFQVLPK PA
3
593-645 (53) CLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDR PA
3
646-665 (20) VALETQWLQLEQEVVWLLAK PA
2
666-688 (23) LGVQSPLPPVTGSNCQCNVEVVR PA
2
689-696 (8) ALTVMLHR PA
3
722-733 (12) DTVLLLHGLSQK PA
3
736-760 (25) LFMMHCVEVLHQFDQVMPGVSMLIR PA
3
761-791 (31) GLPDVTDCEEAALDDLCAAETDVEDPEVECG PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center