Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WXE1-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-29 (13) DNFELEVLQAQYK PA
2
37-45 (9) VMEEEVLIK PA
3
54-67 (14) DSLHQTESVLEEQR PA
3
69-77 (9) SHFLLEQEK PA
3
92-102 (11) LQSLQSELQFK PA
3
103-110 (8) DAEMNELR PA
3
122-133 (12) LAAPSVSHVSPR PA
3
135-151 (17) NPSVVIKPEACSPQFGK PA
3
158-182 (25) ESFSANMSLPHPCQTESGYKPLVGR PA
3
183-191 (9) EDSKPHSLR PA
3
212-225 (14) SNTQGSILINLLLK PA
3
226-268 (43) QPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGLR PA
3
269-283 (15) TTGSYDGSFSLSALR PA
3
284-298 (15) EAQNLAFTGLNLVAR PA
3
304-312 (9) DGDPAEGGR PA
3
314-348 (35) AFPLCQLPGAVHFLPLVQFFIGLHCQALQDLAAAK PA
3
350-418 (69) SGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGVGADSAAGEGNR PA
3
424-434 (11) LSDGDMTSALR PA
3
435-447 (13) GVADDQGQHPLLK PA
3
448-473 (26) MLLHLLAFSSAATGHLQASVLTQCLK PA
3
478-489 (12) LAENTSCDFLPR PA
3
490-499 (10) FQCVFQVLPK PA
3
500-552 (53) CLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDR PA
3
553-572 (20) VALETQWLQLEQEVVWLLAK PA
2
573-595 (23) LGVQSPLPPVTGSNCQCNVEVVR PA
2
596-603 (8) ALTVMLHR PA
3
629-640 (12) DTVLLLHGLSQK PA
3
643-667 (25) LFMMHCVEVLHQFDQVMPGVSMLIR PA
3
668-698 (31) GLPDVTDCEEAALDDLCAAETDVEDPEVECG PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center