Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WXE1-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-11 (9) VMEEEVLIK PA
3
20-33 (14) DSLHQTESVLEEQR PA
3
35-43 (9) SHFLLEQEK PA
3
58-68 (11) LQSLQSELQFK PA
3
69-76 (8) DAEMNELR PA
3
88-99 (12) LAAPSVSHVSPR PA
3
101-117 (17) NPSVVIKPEACSPQFGK PA
3
124-148 (25) ESFSANMSLPHPCQTESGYKPLVGR PA
3
149-157 (9) EDSKPHSLR PA
3
178-191 (14) SNTQGSILINLLLK PA
3
192-234 (43) QPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGLR PA
3
235-249 (15) TTGSYDGSFSLSALR PA
3
250-264 (15) EAQNLAFTGLNLVAR PA
3
270-278 (9) DGDPAEGGR PA
3
280-314 (35) AFPLCQLPGAVHFLPLVQFFIGLHCQALQDLAAAK PA
3
316-384 (69) SGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGVGADSAAGEGNR PA
3
390-400 (11) LSDGDMTSALR PA
3
401-413 (13) GVADDQGQHPLLK PA
3
414-439 (26) MLLHLLAFSSAATGHLQASVLTQCLK PA
3
444-455 (12) LAENTSCDFLPR PA
3
456-465 (10) FQCVFQVLPK PA
3
466-518 (53) CLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDR PA
3
519-538 (20) VALETQWLQLEQEVVWLLAK PA
2
539-561 (23) LGVQSPLPPVTGSNCQCNVEVVR PA
2
562-569 (8) ALTVMLHR PA
3
595-606 (12) DTVLLLHGLSQK PA
3
609-633 (25) LFMMHCVEVLHQFDQVMPGVSMLIR PA
3
634-664 (31) GLPDVTDCEEAALDDLCAAETDVEDPEVECG PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center