Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WXQ3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MEVLGFSNSK PA
0
18-35 (18) QLEIWMEMAPSKPEPQGK PA
0
36-53 (18) AQQSQPTSVLSAANAAQR PA
0
61-70 (10) EGHSPEDYGR PA
0
71-106 (36) QWAENVENHPEVAAHTSCLQSITPHFIAGEMGCTAK PA
0
107-121 (15) ESQEQVPASITQILR PA
0
135-160 (26) CLHLASSVDPIPGLQFFIVIVSDHQK PA
0
175-194 (20) EIHWIPLFTMWSWLQCVEDR PA
0
202-231 (30) LEHGDSHQTESLLDVLVGGFWGVPHTAPPR PA
0
232-252 (21) LQEAGGPTGGCGVGGQPLGGR PA
0
253-324 (72) GQWVGEETGPVGGPHAWWVPPTAPGTSLVLLVLLAQPFQSSEWMPVSSHTPPGTQTNTAALLNVCTSYSEYV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center