Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8WZ71-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MLPLLAALLAAACPLPPVR PA
1
20-49 (30) GGAADAPGLLGVPSNASVNASSADEPIAPR PA
1
50-80 (31) LLASAAPGPPERPGPEEAAAAAAPCNISVQR PA
1
81-89 (9) QMLSSLLVR PA
1
95-110 (16) GFQCDLLLFSTNAHGR PA
1
111-119 (9) AFFAAAFHR PA
1
120-141 (22) VGPPLLIEHLGLAAGGAQQDLR PA
1
142-150 (9) LCVGCGWVR PA
1
157-214 (58) LRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWR PA
1
218-259 (42) KPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQR PA
1
261-286 (26) TTASTTAATPAAAAAAAAVTSGVATK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center