Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92539-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MNYVGQLAGQVIVTVK PA
0
21-51 (31) GINQATLSGCIDVIVVQQQDGSYQCSPFHVR PA
0
64-79 (16) VIDIEINGSAVDLHMK PA
0
80-98 (19) LGDNGEAFFVEETEEEYEK PA
0
99-116 (18) LPAYLATSPIPTEDQFFK PA
0
117-124 (8) DIDTPLVK PA
0
125-153 (29) SGGDETPSQSSDISHVLETETIFTPSSVK PA
0
169-191 (23) EEQAASAAAEDTCDVGVSSDDDK PA
0
198-205 (8) GSSNASLK PA
0
211-242 (32) EPLLFHSGDHYPLSDGDWSPLETTYPQTACPK PA
0
243-257 (15) SDSELEVKPAESLLR PA
0
258-274 (17) SESHMEWTWGGFPESTK PA
0
287-299 (13) TATITPSENTHFR PA
0
300-313 (14) VIPSEDNLISEVEK PA
0
314-330 (17) DASMEDTVCTIVKPKPR PA
0
331-381 (51) ALGTQMSDPTSVAELLEPPLESTQISSMLDADHLPNAALAEAPSESKPAAK PA
0
395-409 (15) SQHQGPDDIYLDDLK PA
0
410-422 (13) GLEPEVAALYFPK PA
0
423-430 (8) SESEPGSR PA
0
431-485 (55) QWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISK PA
0
488-513 (26) FMEHIITYHEFAENPGLIDNPNLVIR PA
0
518-536 (19) YYNWALAAPMILSLQVFQK PA
0
541-548 (8) ATVESWVK PA
0
579-592 (14) SEAPPASDLPSSSK PA
0
593-636 (44) EPAGARPAENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYK PA
0
641-648 (8) LSSDQIAK PA
0
651-671 (21) LHDGPNDVVFSITTQYQGTCR PA
0
672-684 (13) CAGTIYLWNWNDK PA
0
685-696 (12) IIISDIDGTITK PA
0
697-709 (13) SDALGQILPQLGK PA
0
710-718 (9) DWTHQGIAK PA
6
719-729 (11) LYHSINENGYK PA
0
737-745 (9) AIGMADMTR PA
6
746-754 (9) GYLHWVNDK PA
0
761-776 (16) GPLMLSPSSLFSAFHR PA
0
788-795 (8) IECLNDIK PA
0
803-828 (26) QPFYAAFGNRPNDVYAYTQVGVPDCR PA
0
853-866 (14) LSELVEHVFPLLSK PA
0
867-884 (18) EQNSAFPCPEFSSFCYWR PA
0
885-896 (12) DPIPEVDLDDLS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center