Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92597-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-66 (62) TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLK PA
1
67-82 (16) SIIGMGTGAGAYILTR PA
2
83-113 (31) FALNNPEMVEGLVLINVNPCAEGWMDWAASK PA
2
114-132 (19) ISGWTQALPDMVVSHLFGK PA
2
133-146 (14) EEMQSNVEVVHTYR PA
2
147-168 (22) QHIVNDMNPGNLHLFINAYNSR PA
2
170-209 (40) DLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSK PA
2
220-234 (15) MADCGGLPQISQPAK PA
2
241-256 (16) YFVQGMGYMPSASMTR PA
2
262-275 (14) TASGSSVTSLDGTR PA
2
278-285 (8) SHTSEGTR PA
2
288-295 (8) SHTSEGTR PA
2
298-322 (25) SHTSEGAHLDITPNSGAAGNSAGPK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center