Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92597-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-51 (51) MQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLK PA
0
52-67 (16) SIIGMGTGAGAYILTR PA
2
68-98 (31) FALNNPEMVEGLVLINVNPCAEGWMDWAASK PA
2
99-117 (19) ISGWTQALPDMVVSHLFGK PA
2
118-131 (14) EEMQSNVEVVHTYR PA
2
132-153 (22) QHIVNDMNPGNLHLFINAYNSR PA
2
155-194 (40) DLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSK PA
2
205-219 (15) MADCGGLPQISQPAK PA
2
226-241 (16) YFVQGMGYMPSASMTR PA
2
247-260 (14) TASGSSVTSLDGTR PA
2
263-270 (8) SHTSEGTR PA
2
273-280 (8) SHTSEGTR PA
2
283-307 (25) SHTSEGAHLDITPNSGAAGNSAGPK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center