Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92750-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-34 (34) MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVR PA
1
35-47 (13) VESTPVALGAVTK PA
1
48-63 (16) APVSVCVEPTASQPLR PA
1
64-72 (9) SPVGTLVTK PA
1
73-81 (9) VAPVSAPPK PA
1
88-97 (10) LPAPQIVAVK PA
1
98-120 (23) APNTTTIQFPANLQLPPGTVLIK PA
1
121-137 (17) SNSGPLMLVSPQQTVTR PA
1
138-158 (21) AETTSNITSRPAVPANPQTVK PA
1
159-171 (13) ICTVPNSSSQLIK PA
1
181-240 (60) LAQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLK PA
1
241-260 (20) AENSAAVQINLSPTMLENVK PA
1
264-271 (8) NFLAMLIK PA
1
272-287 (16) LACSGSQSPEMGQNVK PA
1
289-297 (9) LVEQLLDAK PA
1
298-305 (8) IEAEEFTR PA
1
313-324 (12) SSPQPHLVPFLK PA
1
332-378 (47) QLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEK PA
1
379-389 (11) SIIVSGATAPR PA
1
390-406 (17) TVSVQTLNPLAGPVGAK PA
1
407-507 (101) AGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAICLPSVKP
VVSSAGTTSDKPVIGTPVQIK PA
1
508-528 (21) LAQPGPVLSQPAGIPQAVQVK PA
1
529-541 (13) QLVVQQPSGGNEK PA
1
542-556 (15) QVTTISHSSTLTIQK PA
1
561-580 (20) TMPVNTIIPTSQFPPASILK PA
1
581-588 (8) QITLPGNK PA
1
589-599 (11) ILSLQASPTQK PA
1
604-611 (8) ENVTSCFR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center