Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92952-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MNSHSYNGSVGRPLGSGPGALGR PA
0
24-48 (25) DPPDPEAGHPPQPPHSPGLQVVVAK PA
1
49-60 (12) SEPARPSPGSPR PA
1
61-79 (19) GQPQDQDDDEDDEEDEAGR PA
1
82-92 (11) ASGKPSNVGHR PA
1
106-134 (29) LSDYALIFGMFGIVVMVTETELSWGVYTK PA
1
135-143 (9) ESLYSFALK PA
1
144-163 (20) CLISLSTAILLGLVVLYHAR PA
1
164-178 (15) EIQLFMVDNGADDWR PA
2
186-206 (21) VFLISLELAVCAIHPVPGHYR PA
1
213-237 (25) LAFTYAPSVAEADVDVLLSIPMFLR PA
1
251-258 (8) IFTDASSR PA
1
276-302 (27) TLMTICPGTVLLVFSISSWIIAAWTVR PA
1
311-344 (34) QEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGK PA
1
345-367 (23) GVCLLTGIMGAGCTALVVAVVAR PA
6
377-389 (13) HVHNFMMDTQLTK PA
6
393-400 (8) NAAANVLR PA
6
427-436 (10) FLQAIHQAQK PA
1
447-459 (13) LNDQANTLTDLAK PA
1
460-481 (22) TQTVMYDLVSELHAQHEELEAR PA
1
489-528 (40) LDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAAR PA
1
534-543 (10) WTPVAPSDCG PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center