Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q92952-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-41 (36) AACSEPNPCTQVVMNSHSYNGSVGRPLGSGPGALGR PA
0
42-66 (25) DPPDPEAGHPPQPPHSPGLQVVVAK PA
1
67-78 (12) SEPARPSPGSPR PA
1
79-97 (19) GQPQDQDDDEDDEEDEAGR PA
1
100-110 (11) ASGKPSNVGHR PA
1
124-152 (29) LSDYALIFGMFGIVVMVTETELSWGVYTK PA
1
153-161 (9) ESLYSFALK PA
1
162-181 (20) CLISLSTAILLGLVVLYHAR PA
1
182-196 (15) EIQLFMVDNGADDWR PA
2
204-224 (21) VFLISLELAVCAIHPVPGHYR PA
1
231-255 (25) LAFTYAPSVAEADVDVLLSIPMFLR PA
1
269-276 (8) IFTDASSR PA
1
294-320 (27) TLMTICPGTVLLVFSISSWIIAAWTVR PA
1
329-362 (34) QEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGK PA
1
363-385 (23) GVCLLTGIMGAGCTALVVAVVAR PA
6
395-407 (13) HVHNFMMDTQLTK PA
6
411-418 (8) NAAANVLR PA
6
445-454 (10) FLQAIHQAQK PA
1
465-477 (13) LNDQANTLTDLAK PA
1
478-499 (22) TQTVMYDLVSELHAQHEELEAR PA
1
507-546 (40) LDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAAR PA
1
552-561 (10) WTPVAPSDCG PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center