Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q969G3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-40 (37) RPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYR PA
1
41-50 (10) LGGNPGTNSR PA
1
51-75 (25) VTASSGITIPKPPKPPDKPLMPYMR PA
1
113-123 (11) QEYLNEYEAEK PA
5
124-131 (8) IEYNESMK PA
5
132-146 (15) AYHNSPAYLAYINAK PA
5
149-158 (10) AEAALEEESR PA
5
167-189 (23) GEPYMSIQPAEDPDDYDDGFSMK PA
5
202-216 (15) LISEILSESVVPDVR PA
5
230-239 (10) QVQSLMVHQR PA
5
241-251 (11) LEAELLQIEER PA
5
259-271 (13) FLESTDSFNNELK PA
5
285-297 (13) IAAEIAQAEEQAR PA
5
306-313 (8) EAAEQAER PA
5
314-328 (15) SQSSIVPEEEQAANK PA
5
334-344 (11) DDENIPMETEK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center