Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q969G3-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
43-53 (11) QEYLNEYEAEK PA
5
54-61 (8) IEYNESMK PA
5
62-76 (15) AYHNSPAYLAYINAK PA
5
79-88 (10) AEAALEEESR PA
5
97-119 (23) GEPYMSIQPAEDPDDYDDGFSMK PA
5
132-146 (15) LISEILSESVVPDVR PA
5
160-169 (10) QVQSLMVHQR PA
5
171-181 (11) LEAELLQIEER PA
5
189-201 (13) FLESTDSFNNELK PA
5
215-227 (13) IAAEIAQAEEQAR PA
5
236-243 (8) EAAEQAER PA
5
244-258 (15) SQSSIVPEEEQAANK PA
5
264-297 (34) DDENIPMETEETHLEETTESQQNGEEGTSTPEDK PA
2
298-339 (42) ESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center