Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q969G3-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-40 (37) RPSYAPPPTPAPATASSGITIPKPPKPPDKPLMPYMR PA
1
78-88 (11) QEYLNEYEAEK PA
5
89-96 (8) IEYNESMK PA
5
97-111 (15) AYHNSPAYLAYINAK PA
5
114-123 (10) AEAALEEESR PA
5
132-154 (23) GEPYMSIQPAEDPDDYDDGFSMK PA
5
167-181 (15) LISEILSESVVPDVR PA
5
195-204 (10) QVQSLMVHQR PA
5
206-216 (11) LEAELLQIEER PA
5
224-236 (13) FLESTDSFNNELK PA
5
250-262 (13) IAAEIAQAEEQAR PA
5
271-278 (8) EAAEQAER PA
5
279-293 (15) SQSSIVPEEEQAANK PA
5
299-332 (34) DDENIPMETEETHLEETTESQQNGEEGTSTPEDK PA
2
333-374 (42) ESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center