Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q969Q6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MIGEEAMINYENFLK PA
0
36-44 (9) LLHTDSYGR PA
1
45-56 (12) ISIMQFFNYVMR PA
1
65-79 (15) IGLSLYDVAGQGYLR PA
1
80-102 (23) ESDLENYILELIPTLPQLDGLEK PA
1
103-114 (12) SFYSFYVCTAVR PA
1
116-124 (9) FFFFLDPLR PA
1
130-146 (17) IQDILACSFLDDLLELR PA
1
153-167 (15) ESQETNWFSAPSALR PA
1
168-177 (10) VYGQYLNLDK PA
1
178-185 (8) DHNGMLSK PA
1
191-203 (13) YGTATMTNVFLDR PA
1
204-218 (15) VFQECLTYDGEMDYK PA
1
219-230 (12) TYLDFVLALENR PA
1
232-241 (10) EPAALQYIFK PA
1
249-261 (13) GYLNVFSLNYFFR PA
1
269-281 (13) IHGQDPVSFQDVK PA
1
282-291 (10) DEIFDMVKPK PA
1
296-326 (31) ISLQDLINSNQGDTVTTILIDLNGFWTYENR PA
1
327-343 (17) EALVANDSENSADLDDT PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center