Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96B77-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
15-34 (20) AVWERPLHGLWCCSGQEDPK PA
0
36-45 (10) WVGSSSPISK PA
0
48-55 (8) LPNAETEK PA
0
76-125 (50) LAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISGFALTMLCWMSYFLR PA
0
127-141 (15) LVGILYLNESGTMLR PA
0
142-151 (10) VAHLNFWGWR PA
0
152-168 (17) QDTYCPMADVIPLTETK PA
0
169-177 (9) DRPQEMFVR PA
0
185-192 (8) QTFYVTLR PA
0
202-213 (12) FTQVFGVHQMLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center