Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96BM1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-23 (17) RPGGGADGGPEASGAAR PA
0
33-42 (10) SSFAFYQAVR PA
0
43-54 (12) DLLPVWLLEDMR PA
0
55-64 (10) ASEAFHWDER PA
0
67-97 (31) AAAYSPSEALLYALVHDHQAYAHYLLATFPR PA
0
99-108 (10) ALAPPSAGFR PA
0
109-122 (14) CCAAPGPHVALAVR PA
0
156-188 (33) VEGGGTSLHVACELARPECLFLLLGHGASPGLR PA
0
189-201 (13) DGGGLTPLELLLR PA
0
206-225 (20) DAGATPSAAGAPASAPGEPR PA
0
229-248 (20) LLLLDLLALYTPVGAAGSAR PA
0
249-257 (9) QELLGDRPR PA
0
267-281 (15) FQWLAGLAPPSLFAR PA
0
282-294 (13) AMQVLVTAISPGR PA
0
295-316 (22) FPEALDELPLPPFLQPLDLTGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center