Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96BR1-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-25 (15) ESCPSVSIPSSDEHR PA
1
64-71 (8) QFPAMALK PA
1
77-88 (12) IFGDNFDPDFIK PA
1
92-103 (12) AGLNEFIQNLVR PA
1
104-114 (11) YPELYNHPDVR PA
1
115-123 (9) AFLQMDSPK PA
1
124-135 (12) HQSDPSEDEDER PA
1
140-166 (27) LHSTSQNINLGPSGNPHAKPTDFDFLK PA
1
220-235 (16) HPFLVGLHYSFQTTEK PA
1
236-254 (19) LYFVLDFVNGGELFFHLQR PA
1
265-281 (17) FYAAEIASALGYLHSIK PA
1
286-309 (24) DLKPENILLDSVGHVVLTDFGLCK PA
1
310-332 (23) EGIAISDTTTTFCGTPEPPFYCR PA
0
333-366 (34) DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEK PA
1
376-398 (23) EDFLEIQNHPFFESLSWADLVQK PA
1
400-415 (16) IPPPFNPNVAGPDDIR PA
1
416-464 (49) NFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center