Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96BR9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MEISSHQSHLLQQLNEQR PA
1
20-33 (14) QDVFCDCSILVEGK PA
1
40-50 (11) NVLFASSGYFK PA
1
51-58 (8) MLLSQNSK PA
1
59-87 (29) ETSQPTTATFQAFSPDTFTVILDFVYSGK PA
1
88-115 (28) LSLTGQNVIEVMSAASFLQMTDVISVCK PA
1
120-127 (8) SSLDISEK PA
1
139-147 (9) DANSNGVER PA
1
148-163 (16) SSFYSGGWQEGSSSPR PA
1
164-178 (15) SHLSPEQGTGIISGK PA
1
183-191 (9) YNYHPASQK PA
1
192-199 (8) NTQQPLAK PA
1
215-225 (11) LSQPSEVTHYK PA
1
233-271 (39) TSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSK PA
1
272-279 (8) SFPDDLPR PA
1
284-292 (9) CPYCTHVVK PA
1
303-317 (15) CHTGERPYPCQACGK PA
1
322-330 (9) LDHLSSHFR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center