Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96BY2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
20-50 (31) ALLIAGISQSCSVAEIEEALQAGLAPLGEYR PA
0
64-80 (17) VALVGLTAETSHALVPK PA
0
91-105 (15) VIFKPPDPDNTFLSR PA
0
106-122 (17) LNEFLAGEGMTVGELSR PA
0
123-161 (39) ALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLK PA
0
172-183 (12) ESPEPGEEEFGR PA
0
184-193 (10) WMFHTTQMIK PA
0
194-202 (9) AWQVPDVEK PA
0
212-219 (8) GPALDVIR PA
0
223-248 (26) INNPLITVDECLQALEEVFGVTDNPR PA
0
295-305 (11) LDQVIAGAVHK PA
0
310-330 (21) ELNLPEDGPAPGFLQLLVLIK PA
0
331-351 (21) DYEAAEEEEALLQAILEGNFT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center