Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96CH1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-56 (56) MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSK PA
0
57-91 (35) ASMTMPDVYFVNMAVAGLVLSALAPVHLLGPPSSR PA
0
92-131 (40) WALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIER PA
0
136-145 (10) TYMASVYNTR PA
0
146-174 (29) HVCGFVWGGALLTSFSSLLFYICSHVSTR PA
0
181-212 (32) MQNAEAADATLVFIGYVVPALATLYALVLLSR PA
0
234-262 (29) LLVATVCTQFGLWTPHYLILLGHTVIISR PA
0
263-278 (16) GKPVDAHYLGLLHFVK PA
0
283-297 (15) LLAFSSSFVTPLLYR PA
0
298-306 (9) YMNQSFPSK PA
0
320-333 (14) HCSPDHMGVQQVLA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center