Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96CV9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MSHQPLSCLTEK PA
1
13-45 (33) EDSPSESTGNGPPHLAHPNLDTFTPEELLQQMK PA
1
46-55 (10) ELLTENHQLK PA
1
69-78 (10) FEELSAWTEK PA
2
84-91 (8) QFFEIQSK PA
2
97-106 (10) LMALSHENEK PA
2
121-130 (10) SSEDPTDDSR PA
2
155-167 (13) ADLLGIVSELQLK PA
2
168-182 (15) LNSSGSSEDSFVEIR PA
2
183-193 (11) MAEGEAEGSVK PA
2
204-213 (10) TVSTGTALSK PA
1
224-241 (18) NYFEHEELTVSQLLLCLR PA
2
272-284 (13) SEIETQTEGSTEK PA
2
291-311 (21) GPETVGSEVEALNLQVTSLFK PA
2
312-319 (8) ELQEAHTK PA
2
341-351 (11) NSAIPSELNEK PA
2
352-359 (8) QELVYTNK PA
2
361-373 (13) LELQVESMLSEIK PA
2
386-395 (10) LTVLQMTHNK PA
2
396-405 (10) LLQEHNNALK PA
2
441-448 (8) QLQMDEMK PA
2
454-465 (12) QEEDLETMTILR PA
2
466-479 (14) AQMEVYCSDFHAER PA
2
490-501 (12) EQLALQLAVLLK PA
2
502-511 (10) ENDAFEDGGR PA
2
512-520 (9) QSLMEMQSR PA
2
525-537 (13) TSDSDQQAYLVQR PA
2
549-557 (9) NIPIHSCPK PA
2
558-577 (20) CGEVLPDIDTLQIHVMDCII PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center